SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L0FKT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0FKT2
Domain Number 1 Region: 27-344
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.68e-61
Family Phosphate binding protein-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L0FKT2
Sequence length 347
Comment (tr|L0FKT2|L0FKT2_PSEPU) Uncharacterized protein {ECO:0000313|EMBL:AGA73351.1} KW=Complete proteome OX=1215088 OS=Pseudomonas putida HB3267. GN=B479_12275 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MQVFPRVSSLCAALLAMGLGSAQAAPQMVVVGYGGAGQKAQDESIFKPFSAQDGSKLIQS
EYNGEMARIQVMAETGNVDWDVVQIEGPDLMRGCDEGIYEQLDWQRMGHAGELITDAAQA
CGSAALVWSVAIAYDRSKLAQAPASWADFWDVSKYPGKRGLRKRAVYNLEFALMADGVKV
EDVYQVLATPAGVERAFAKLSELKPYIQWWDAGAQPAQWLAAGDVVMTSTYSGRIAVAAQ
QGSPLAVVWPGSLYGMDYWAIIKGSRHVDQAKRLIAYANQPDTQVRYVQQIPYGPTNTQA
AAKLDPSLASWVPTSPQNLQGALAMNVEFWVDHGEELEQRFNAWASK
Download sequence
Identical sequences L0FKT2
WP_015270176.1.71677 gi|431802391|ref|YP_007229294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]