SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L0FN48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0FN48
Domain Number 1 Region: 5-175
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.71e-33
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L0FN48
Sequence length 177
Comment (tr|L0FN48|L0FN48_PSEPU) Uncharacterized protein {ECO:0000313|EMBL:AGA75379.1} KW=Complete proteome OX=1215088 OS=Pseudomonas putida HB3267. GN=B479_22450 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNSDGTVQLWDPLLRLCHWSIAVVFFANYFFNEEGEGWHQWLGYYALAVVVVRVVWGFVG
PRSARWADFWPSPASLVGHARALLHGGLDHHMGHSPIGALVMVLMLTCIAGLGLTGWASQ
EVDALFGVDWPMDLHSWLANALLVLVCVHVLAAIYESVRMRENLPWSMITGRRRHRD
Download sequence
Identical sequences A0A0N8HFQ2 A0A136QIV4 L0FN48
gi|431804419|ref|YP_007231322.1| WP_015271788.1.57632 WP_015271788.1.71677 WP_015271788.1.95946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]