SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L0FTA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0FTA0
Domain Number 1 Region: 25-364
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.65e-97
Family Phosphate binding protein-like 0.00000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L0FTA0
Sequence length 365
Comment (tr|L0FTA0|L0FTA0_PSEPU) Uncharacterized protein {ECO:0000313|EMBL:AGA75976.1} KW=Complete proteome OX=1215088 OS=Pseudomonas putida HB3267. GN=B479_25435 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNKLGKMLLATALMGAMATAVQAEDKVLNVYNWSDYIAPDTIAKFEKQSGIKVKYDVFDS
NETLEAKLLAGKSGYDIVVPSNNFLAKQIKAGVYEELDRSKLPNWKNLDPDLLKAVGDAS
DKDNKHAFPYMWGSIGIGYNPEKVKAALGVDKIDSWDVVFKPENIAKLKSCGVSFLDAPT
EMLPAALHYLGLPTDSTKKEDLKAAEDLFLKIRPSITYFHSSKYIGDMANGNICVAVGYS
GDLEQSKARAHEAGDKVKVDYVIPKEGAGTFYDMVAIPKDAEHKDAAYQFMNFLMQPEIM
AEITNAVRFPNGNAAATQFVDKEITSDPSIYPPAEVKKQLYAIAAPEASAQRVITRSWTK
IKSGK
Download sequence
Identical sequences L0FTA0
gi|431805016|ref|YP_007231919.1| WP_015272219.1.71677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]