SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L0KUW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0KUW4
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily GlnB-like 1.07e-32
Family Divalent ion tolerance proteins CutA (CutA1) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L0KUW4
Sequence length 103
Comment (tr|L0KUW4|L0KUW4_METHD) Uncharacterized protein involved in tolerance to divalent cations {ECO:0000313|EMBL:AGB48911.1} KW=Complete proteome; Reference proteome OX=867904 OS=DMS1). GN=Metho_0655 OC=Methanosarcinaceae; Methanomethylovorans.
Sequence
MIIVVHTTTANMDEAKSIANALVEKGFAACVSMHPVTSVYKWKGNIEEEGEIELSIKTTS
EMLESVKKAIIYMHSYELPALIWWPVDGDEKYTEWIVDCVKPE
Download sequence
Identical sequences L0KUW4
WP_015324079.1.68990 gi|435850855|ref|YP_007312441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]