SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L0L0C4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L0L0C4
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily GlnB-like 1.45e-29
Family DUF190/COG1993 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L0L0C4
Sequence length 108
Comment (tr|L0L0C4|L0L0C4_METHD) Uncharacterized protein {ECO:0000313|EMBL:AGB50385.1} KW=Complete proteome; Reference proteome OX=867904 OS=DMS1). GN=Metho_2222 OC=Methanosarcinaceae; Methanomethylovorans.
Sequence
MKHVILRIYLSEKDSYRGKAAYHAVIEFFKKAGIAGVTVHHCIAGYGVDHVIHTANVLRL
GADLPIIVQAVDAEDKIRSIIPKLRQMLPRELMILQEVEVIPPSVVHK
Download sequence
Identical sequences L0L0C4
gi|435852329|ref|YP_007313915.1| WP_015325550.1.68990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]