SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L5KR51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L5KR51
Domain Number 1 Region: 32-292
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-55
Family YWTD domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 644-899
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-54
Family YWTD domain 0.00000646
Further Details:      
 
Domain Number 3 Region: 343-573
Classification Level Classification E-value
Superfamily YWTD domain 1.02e-50
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 946-1207
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-37
Family YWTD domain 0.0000677
Further Details:      
 
Domain Number 5 Region: 1336-1372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1298-1334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1258-1296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 902-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.027
Further Details:      
 
Domain Number 9 Region: 599-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 10 Region: 297-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000649
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1215-1267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L5KR51
Sequence length 1616
Comment (tr|L5KR51|L5KR51_PTEAL) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=9402 OS=Pteropus alecto (Black flying fox). GN=PAL_GLEAN10011267 OC=Pteropodidae; Pteropodinae; Pteropus.
Sequence
MSRRDRLARRRADCEAFFPGHVVLAQGRTASPLLLFANRRDVRLVDAGGVKLESTVVVSG
LEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQSVVISGLVSPDGLACDWVGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAVALDPAHGYMYWTDWGETPRIERAGM
DGSTRKVIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILGALYSPMDIQVLSPERQPYFHTQCEE
DNGGCSHLCLLSPREPFYTCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPD
FTDIVMQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGI
AVDWVARNLYWTDTGTDRIEVARLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGEN
PKIECADLDGQERHVLVNTSLGWPNGLALDLQEGKVYWGDAKTDKIEVINVDGTKRRTLL
EDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVG
TNPCADRNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLE
TSSNDVAIPLTGVKEASALDFDVSSGHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPE
GMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWG
GKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQGRVVI
ADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLVQGHLDFVMDLLVFHASRQD
GLNDCVHSNGQCGQLCLAIPGGRRCSCASHYTLDPSGRNCSPPSTFLLFSQKNAISRMIP
DDQHSPDLMLPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQASPSILTSPSPN
QNPDRQPHDLSIDVYSRTLFWTCEATNTINVHRLNGDAMGVVLRGDRDKPRAIVVNAERG
YLYFTNMQEPAAKIERTALDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESC
DLSGANRLTLEDANVVQPVGLAVLGRHLYWIDRQQQMIERVEKTSGDKRTRVQGRVAHLT
GIHAVEDVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTC
SPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDG
EADCQDRSDEADCDAICLPSQFRCASGQCVLIKQQCDSFPDCVDGSDELMCEISKPPSDD
TPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYTGASGPFPHEYVSGTPHVPLNFIA
PGASQHGPFTGISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILN
PPPSPATDPSLYNVDTFYSSSVPAPARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKA
SKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences L5KR51

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]