SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L7FKV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L7FKV8
Domain Number - Region: 19-86
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000275
Family Myosin rod fragments 0.0071
Further Details:      
 
Domain Number - Region: 115-349
Classification Level Classification E-value
Superfamily Tropomyosin 0.00229
Family Tropomyosin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L7FKV8
Sequence length 356
Comment (tr|L7FKV8|L7FKV8_ENTIV) M protein, serotype 12, putative {ECO:0000313|EMBL:ELP87076.1} KW=Complete proteome; Reference proteome OX=370355 OS=Entamoeba invadens IP1. GN=EIN_028610 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MKSQEDQKHIEELRKDSVITELNKDIEDKEGEISDLKKKLEAEEDNPKDLETQLHEKEDD
IADLEKQVKKLQNTISDVNAQNEDIDSKVSDERDGYNQQLQAEKTKTAALTSAKNASDKK
ISLLNSEKDELEDKNRKIAELTKRIEDGLNDSDMLKAQKADYEAQIQALKDDMEKTEKYL
AAALNEEVEAANEKLRITKNDLGRTKAELDQLQQNFDYLKKNADTDTVDKKKLNGTVNKS
NKKIEELSVKVDELTGVITKIEQEVVEANEELETVNKDKFAKEKEAKRLKAKTTKLKRRR
NIADLEQQVQDFEDKVGTSNIDQTEVIKRHNQIVDLENEVAVLKDQNTQLDAAKKI
Download sequence
Identical sequences L7FKV8
jCVI|EIN_018450 XP_004253847.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]