SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L7FLJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L7FLJ8
Domain Number - Region: 44-134
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L7FLJ8
Sequence length 139
Comment (tr|L7FLJ8|L7FLJ8_ENTIV) Uncharacterized protein {ECO:0000313|EMBL:ELP88744.1} KW=Complete proteome; Reference proteome OX=370355 OS=Entamoeba invadens IP1. GN=EIN_104770 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MVQSKSYKETLEANNTEINIADLEQQVQDLEERPVVTSNIDQTEVIKRDNQIADLEKAVA
ALKEQNTRLDAAKKDMKKQSVEDASKIKNYESQIKAFEAQKKMALDDKTEDEKTAADQSD
RRKKMEDQVKAFNAQVLSL
Download sequence
Identical sequences L7FLJ8
XP_004255515.1.21224 jCVI|EIN_065820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]