SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L7FMF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L7FMF6
Domain Number - Region: 10-63
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0157
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L7FMF6
Sequence length 127
Comment (tr|L7FMF6|L7FMF6_ENTIV) Uncharacterized protein {ECO:0000313|EMBL:ELP88742.1} KW=Complete proteome; Reference proteome OX=370355 OS=Entamoeba invadens IP1. GN=EIN_104750 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MENENEFGEYKEHFDEFINSLTAQKADSQKELEKERAMKQKPDKETQKLRVKVTDSEAKL
ADAGATGASIAKLKAKQKRKKHKTQLLKLRNKLNSMPERLKRLRESLQNSNRKSLHSTLI
LVRHKPI
Download sequence
Identical sequences L7FMF6
jCVI|EIN_065800 XP_004255513.1.21224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]