SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L7ZX54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L7ZX54
Domain Number 1 Region: 128-228,387-462
Classification Level Classification E-value
Superfamily TrmE connector domain 3.27e-51
Family TrmE connector domain 0.00038
Further Details:      
 
Domain Number 2 Region: 81-170,205-379
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-47
Family G proteins 0.0000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L7ZX54
Sequence length 462
Comment (tr|L7ZX54|L7ZX54_9BACI) tRNA modification GTPase MnmE {ECO:0000256|HAMAP-Rule:MF_00379} KW=Complete proteome OX=1233873 OS=Geobacillus sp. GHH01. GN=GHH_c35840 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MTEFDTIAAISTPMGEGAIAIVRLSGDQAVEIADRLFRSPSGKRLKDVPSHTIHYGHIID
PKSGRVVEEVMVSVMRAPKTFTREDVVEINCHGGFVSVNRVLQLVLANGARLAEPGEFTK
RAFLNGRIDLSQAEAVIDLIRAKTDRAMNVALQQMEGRLSKLIRELRQTILETLAHVEVN
IDYPEYDDVEEMTPRLLREKAEYVRGQIEKLLSTAAQGKILREGLATVIIGRPNVGKSSL
LNALAHENRAIVTDIPGTTRDVIEEYVNVRGVPLRLIDTAGIRETEDVVERIGVERSQQM
LKRADLILLVLNYHEPLTEEDERLFAMIEGMDAIVIVNKTDLPRRIDMERVKELAAGRPV
VGTSLLHEQGIDELEKAIADLFFGGELEAGDLTYVSNSRHIALLEQAKTAIEDALAGIDA
GMPVDLVQIDLRRAWELLGEIIGDTVHESLIDQLFAQFCLGK
Download sequence
Identical sequences A0A0E0TH28 A0A0K2H9J6 A0A1V9BWG0 A0A2H5KID1 L7ZX54 Q5KU57 S7SWW1 T0NZ77 V6VEN1
235909.GK3494 544556.GYMC61_3557 gi|448239766|ref|YP_007403824.1| gi|261420902|ref|YP_003254584.1| gi|56422029|ref|YP_149347.1| WP_011232957.1.100150 WP_011232957.1.17728 WP_011232957.1.20723 WP_011232957.1.2219 WP_011232957.1.25743 WP_011232957.1.38928 WP_011232957.1.45808 WP_011232957.1.50933 WP_011232957.1.59104 WP_011232957.1.60903 WP_011232957.1.6497 WP_011232957.1.70239 WP_011232957.1.80994 WP_011232957.1.90668 WP_011232957.1.92435 gi|319768573|ref|YP_004134074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]