SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L8AG54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8AG54
Domain Number 1 Region: 41-249
Classification Level Classification E-value
Superfamily ARM repeat 6.53e-39
Family PBS lyase HEAT-like repeat 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8AG54
Sequence length 252
Comment (tr|L8AG54|L8AG54_BACIU) Uncharacterized protein {ECO:0000313|EMBL:BAM50462.1} KW=Complete proteome OX=1204343 OS=Bacillus subtilis BEST7613. GN=BEST7613_1531 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MRKYGAMRNQDDLLLEDSWVDPLDQLDDDVAPPPPDPDEMLVLLTSREAPQRMLAARAFC
EIADRRAVEPLINLLGDSCPLVRVSAAYALGRNTDPTIVEPLIQSLQTDFNGYVRKGLVW
ALGNCGDRRALAPLIHALKTDISAVRLWSASSLPNIAKLAYEDVIATIPPLIEGLRRDKM
AAVRSNCAWAVGQLCRELPSNVVYATAIDALLEALVEDEDFGVKEDAKSALLRLGDARGL
QMIEDLEMDGLI
Download sequence
Identical sequences L8AG54 P72742
gi|16329349|ref|NP_440077.1| gi|383490144|ref|YP_005407820.1| 1148.slr1098 gi|383324260|ref|YP_005385113.1| gi|383321090|ref|YP_005381943.1| gi|16329349|ref|NP_440077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]