SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8AGF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8AGF0
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 2.35e-26
Family Ribosomal protein L28 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L8AGF0
Sequence length 78
Comment (tr|L8AGF0|L8AGF0_BACIU) 50S ribosomal protein L28 {ECO:0000256|HAMAP-Rule:MF_00373} KW=Complete proteome OX=1204343 OS=Bacillus subtilis BEST7613. GN=BEST7613_1646 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MARRCQLTGKKANNGFAVSHSHRRTKKLQQANLQWKRVWWPEGNRFVRLRLSTTAIKTLE
SKGINAMAKEAGINLNKF
Download sequence
Identical sequences A0A068MWV4 L8AGF0 P72851
gi|383321199|ref|YP_005382052.1| WP_010871496.1.11876 WP_010871496.1.1889 WP_010871496.1.18904 WP_010871496.1.33690 WP_010871496.1.35395 WP_010871496.1.47586 WP_010871496.1.709 WP_010871496.1.99424 gi|383490253|ref|YP_005407929.1| gi|16329458|ref|NP_440186.1| 1148.ssr1604 gi|16329458|ref|NP_440186.1| gi|383324369|ref|YP_005385222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]