SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L8HTR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8HTR5
Domain Number 1 Region: 641-896
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-56
Family YWTD domain 0.00000555
Further Details:      
 
Domain Number 2 Region: 29-289
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-54
Family YWTD domain 0.00000175
Further Details:      
 
Domain Number 3 Region: 340-570
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-51
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 943-1204
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-38
Family YWTD domain 0.0000714
Further Details:      
 
Domain Number 5 Region: 1333-1373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1295-1330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1254-1294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 596-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 9 Region: 899-950
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000301
Family EGF-type module 0.03
Further Details:      
 
Domain Number 10 Region: 295-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000233
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1212-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000167
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8HTR5
Sequence length 1614
Comment (tr|L8HTR5|L8HTR5_9CETA) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:ELR46724.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_19929 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
PGTEPSVPGCAACSSARILTVCFCPTASPLLLFANRRDVRLVDAGGVKVESTIVVSGLED
AAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYW
TDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGS
TRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALT
LSGDTLYWTDWQTRSIHACNKRTGDKRKEILSALYSPMDIQVLSPERQPYYHTRCEEDNG
GCSHLCLLSPREPFYACACPTGVQLQDNGQTCKAGAEEVLLLARRTDLRRISLDTPDFTD
IVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVD
WVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKI
ECANLDGQERHILVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDK
LPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAANVAKVVGTNP
CADRNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLDTNN
NDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMA
VDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKP
RIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVIADD
LPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLN
DCMHNNGQCGQLCLAVPSGHRCSCASHYTLDPSSRNCSPPTTFLLFSQKCAISRMIPDDQ
RSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQASPFVLTSPSQSQNL
DRQPHDLSIDIYSRTLFWTCEATNTINVHRLNGDAMGVVLRGDRDKPRAIVVNAERGYLY
FTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLS
GANRLTLEDANIVQPVGLTVLGKHLYWIDRQQQMIERVDKTTGDARTRVQGRVAHLTGIH
AVEDISLEEFSAHPCARDNGGCSHICVAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPD
QFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEAD
CQDRSDEADCDAVCLPNQFRCASGQCVLIKQQCDSFPDCVDGSDELMCEITKLPSDDGPA
HSSAIGPVIGIILSLFIMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGG
SQHGPFTGISCGKSMMSSVSLMGGRAGVPLYDRNHVTGASSSSSSSTKATLYPPVLTLPC
PVLLNSSKPDFSVMKYSSEAPFPCIPSRPYIIRGVAPPTTPCSTDVCDSDYSASRWKASK
YYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences L8HTR5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]