SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8I598 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8I598
Domain Number 1 Region: 173-322
Classification Level Classification E-value
Superfamily TPR-like 6.27e-19
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 
Domain Number 2 Region: 7-94,132-158
Classification Level Classification E-value
Superfamily FKBP-like 1.2e-18
Family FKBP immunophilin/proline isomerase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8I598
Sequence length 330
Comment (tr|L8I598|L8I598_9CETA) Peptidylprolyl isomerase {ECO:0000256|PROSITE-ProRule:PRU00277} OX=72004 OS=Bos mutus (wild yak). GN=M91_14037 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MADIIARLREDGIQKRVIQEGRGALPDFQDGTKATFHYRTLRSDEEGAVLDDSRVRGKPM
ELIIGKKFKLPVWETIVRTMREGEIAQFCCDVKHVVLYPLVAKSLRNIAAGKDPLEGQRH
CCGIAQMHEHNSLGHADLDALQQNPQPLIFDIEMLKVENPGTYQQDPWAMTDEEKAKAVP
VIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPDWIQLDQQITPLLLNYCQC
KLVAEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLQLDPALAP
VVSRELRALEARIRQKDEEDKARFRGIFSH
Download sequence
Identical sequences L8I598 Q3SZ99 W5PSF4
ENSOARP00000013383 ENSBTAP00000013841 NP_898905.2.59421 NP_898905.2.76553 XP_004019768.1.66739 XP_005700004.1.57651 XP_005903626.1.15283 XP_010835990.1.44457 XP_011972856.1.54773 XP_020743454.1.74333 ENSBTAP00000013841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]