SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L8I8P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L8I8P3
Domain Number - Region: 42-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.000356
Family Fibronectin type I module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L8I8P3
Sequence length 139
Comment (tr|L8I8P3|L8I8P3_9CETA) Beta-microseminoprotein {ECO:0000256|RuleBase:RU364124} OX=72004 OS=Bos mutus (wild yak). GN=M91_01544 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAPRTPWVGQAAGTRGGWGVIYLVVSLLLQHPGVHSKCYFQAQAPCHYEGKYFTLGESWL
RKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPD
PEWGSANTPVPAAPAPHSS
Download sequence
Identical sequences E1BLN8 L8I8P3
ENSBTAP00000048009 XP_002689727.1.76553 XP_002705049.1.59421 XP_005900837.1.15283 XP_010844383.1.44457 ENSBTAP00000048009 9913.ENSBTAP00000048009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]