SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L8IMJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8IMJ4
Domain Number 1 Region: 636-783
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.1e-41
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 962-1060
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.06e-30
Family Ras-binding domain, RBD 0.00095
Further Details:      
 
Domain Number 3 Region: 172-318
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-21
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 
Domain Number 4 Region: 907-976
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000132
Family Ras-binding domain, RBD 0.069
Further Details:      
 
Domain Number 5 Region: 2-46
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000028
Family PDZ domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) L8IMJ4
Sequence length 1381
Comment (tr|L8IMJ4|L8IMJ4_9CETA) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:ELR57283.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_16651 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
LVGLRAGDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGGGHLESCSSDEEFGLY
EGKGWLKPKLDSKALGINRAERVVEEMQSGGIFNMIFENPGLRASSSEPLKLKQRSLSES
AAGRCDLTHESASHPHPSLPSKEETPKAGNHGSAFGAGLEAPEDFGLDASILNVAMVVGY
LGSIELPSAGCSLESDSVQAIRGCLRRLRAEQKIHSLVTMKVMHDCVQLCTDKAAVLARY
PAERLAFSAVCPDDRRFFGLVTMQAGDDGSLAQEEDGTLRTSCHVFMVDPDLFSHKIHQG
IARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGVRARAFADGDADAHQ
NTSTSSNSDSGIGNFSPEDRSSRVLVVDLGAASSRHGPGGGAWEGTGGRGPQPWTAPWNG
AFCLDPEGAPFEAAPQADRCRDLGKHLGPAPHAEGPPGPLRCPVPPSRRGAVGPGGSSSQ
RWLPVHVLRQWQCGHVSDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSPAQPPP
STQRRDWARKALGVQNIFGPHRSVRKTKEDKKGSKFGRGIGLVTPAPRASSRRSFGRSRR
LSITRSLDDLESATVSDGELTGADLKDCVSNHSLSSNASLPSVQSCRRLRERRVASWAVS
FERLLQDPLGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLS
SKATTPVNIDSQAQLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAE
VEGRPLPDAQQVPSSPASKHSASSDHSNTSTPKKLSGKSKSGRSLNEELGDEDSERKRKG
AFFSWSRTRSTGRSQKKKDHGDRPNDALHANGGLGRRESQGSVSSAGSLDLPEACRTLAP
ERDKPAKHCSIQLPDGTACVVLVRAGLSIKDVLAGLCERHGINGAAVDLFLAGGDKPLVL
HQDSSILESRDLRLEKRTLFRLDLVPINRSVGLKAKPSKPVTEVLRPVAAKYGLRLNELV
ARLSGEKEPLDLGAPISSLDGQRVILEEKDPSRGKDKQRSAPVRQSTAVNTSSRNHSATG
EERTLGKSNSIKIKGENGKNAREPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQ
SSRADDQRGLLRKEDLVLPEFLRLPPSPPGLAPSPSAAAKAFDPRPVPVLGAVSCFLDGG
HRDPSVQSERDSMAMLPGREMWSPGLPALCHPEEKVPSGWASVPSAHVQRPVRARGLEAF
GRTHAHAGHSLPAWPAVDLVLLTCLVSSKTLGGDGHVLPQGAPAGCGCRARGRRHPPVSA
VADVDRVTGAPSGPAGSIPGVRTAPWRPRASGAPTLACPTLSPVPGGTAKPKASPHHATF
V
Download sequence
Identical sequences L8IMJ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]