SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L8IYJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8IYJ5
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000455
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 98-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000045
Family Fibronectin type I module 0.049
Further Details:      
 
Domain Number 3 Region: 229-273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000119
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8IYJ5
Sequence length 382
Comment (tr|L8IYJ5|L8IYJ5_9CETA) Protein CYR61 {ECO:0000313|EMBL:ELR61710.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_00765 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSSRTARTLALAVTLLHLARLALSTCPTACHCPLEAPKCAPGVGLVRDACGCCKVCAKQL
NEDCSKTQPCDHTKGLECNFGANSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQ
CTCIDGAVGCIPLCPQELSLPNLGCPNLRLVKVTGQCCEEWVCDDDSAKDPMDDGEGLQG
KELAFDDSEVELTRNNELIAVGKSGFLKRLPVFGMEPRILYNPSSHGQKCIVQTTSWSQC
SKTCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKGKKCSKTKKSPEPVHFT
YAGCSSVKKYRPKYCGSCVDGRCCTPQQTRTVKMRFRCEDGEMFSKNVMMIQSCRCNYNC
PHANEAAFPFYRLFNDIHKFRD
Download sequence
Identical sequences L8IYJ5 Q3ZC35
ENSBTAP00000012977 ENSBTAP00000012977 9913.ENSBTAP00000012977 NP_001029512.1.59421 NP_001029512.1.76553 XP_005888500.1.15283 XP_019812727.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]