SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L8IYM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8IYM7
Domain Number 1 Region: 620-875
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 9-268
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-56
Family YWTD domain 0.00000129
Further Details:      
 
Domain Number 3 Region: 319-565
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 923-1182
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-39
Family YWTD domain 0.0000435
Further Details:      
 
Domain Number 5 Region: 877-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1313-1351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 575-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1235-1273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1275-1311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 271-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000473
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 11 Region: 1192-1245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000542
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) L8IYM7
Sequence length 1601
Comment (tr|L8IYM7|L8IYM7_9CETA) Low-density lipoprotein receptor-related protein 6 {ECO:0000313|EMBL:ELR60499.1} OX=72004 OS=Bos mutus (wild yak). GN=M91_15897 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
FSLFVLAAPLLLYANRRDLRLVDAANGKENATIVVGGLEDAAALDFVFSHGLIYWSDVSE
EAIKRIEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVL
FWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSDRFVIINTEIYWPNGLTLDYE
ERKLYWADAKLNFIHRSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNK
YTGEGLREIHSNIFSPMDIHVFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPT
GVTLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEG
YIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRL
NGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWP
NGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQR
RSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEDNGGCSHLCLYRPQGLRC
ACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVT
DNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVS
KLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGR
ANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSR
RSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGF
VCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDY
DPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTC
EATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTE
REVLFFSGLSKPVALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDTNILQPVGLTV
FENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNG
GCSHICLVKGDGTTRCSCPMHLVLLQDELLCGEPPTCSPQQFTCFTGEIDCIPVAWRCDG
FTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFR
CANGQCIGKHKKCDHNLDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYF
ICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIM
GGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTH
RSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVVTAKGYTSDLNYDSEPVPPPPT
PRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences L8IYM7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]