SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for L8Y2Y7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  L8Y2Y7
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00798
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8Y2Y7
Sequence length 265
Comment (tr|L8Y2Y7|L8Y2Y7_TUPCH) Gamma-secretase subunit APH-1A {ECO:0000313|EMBL:ELV10768.1} KW=Complete proteome; Reference proteome OX=246437 OS=Tupaia chinensis (Chinese tree shrew). GN=TREES_T100021290 OC=Mammalia; Eutheria; Euarchontoglires; Scandentia; Tupaiidae; Tupaia.
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLSCRRQEDSRVMVYSALRIPPED
Download sequence
Identical sequences A0A1U7R9X9 A0A1U7TNP3 A0A250YDX9 A0A2K6F6W4 D2HBU9 L8Y2Y7 M3XG97 M3Y1J8
ENSFCAP00000012923 XP_002715647.1.1745 XP_003990614.1.62641 XP_004404252.1.74151 XP_004436007.1.5094 XP_005084313.1.91757 XP_005378746.1.28644 XP_006168548.1.99106 XP_006728379.1.47382 XP_006902282.1.29581 XP_007088111.1.5354 XP_008061624.1.4292 XP_012514268.1.63892 XP_014940322.1.86478 XP_019288463.1.44245 XP_020011362.1.5219 XP_021543728.1.83697 ENSMPUP00000005199 ENSAMEP00000001853 ENSAMEP00000001853 9685.ENSFCAP00000012923 ENSMPUP00000005199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]