SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L8Y3J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L8Y3J1
Domain Number 1 Region: 485-740
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-55
Family YWTD domain 0.00000572
Further Details:      
 
Domain Number 2 Region: 184-414
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-51
Family YWTD domain 0.00000262
Further Details:      
 
Domain Number 3 Region: 787-1051
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-37
Family YWTD domain 0.0000717
Further Details:      
 
Domain Number 4 Region: 3-133
Classification Level Classification E-value
Superfamily YWTD domain 8.89e-29
Family YWTD domain 0.0000771
Further Details:      
 
Domain Number 5 Region: 1182-1218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 6 Region: 1144-1180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1104-1142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 440-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 9 Region: 743-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000284
Family EGF-type module 0.024
Further Details:      
 
Domain Number 10 Region: 138-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000102
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1061-1113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000887
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L8Y3J1
Sequence length 1462
Comment (tr|L8Y3J1|L8Y3J1_TUPCH) Low-density lipoprotein receptor-related protein 5 {ECO:0000313|EMBL:ELV09490.1} KW=Complete proteome; Reference proteome OX=246437 OS=Tupaia chinensis (Chinese tree shrew). GN=TREES_T100012703 OC=Mammalia; Eutheria; Euarchontoglires; Scandentia; Tupaiidae; Tupaia.
Sequence
MPRYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIH
RANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYS
PMDIQVLSQERQPSFHTQCEEDNGGCSHLCLLSPREPFYACACPTGVQLQDNGRTCKAGA
EEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRA
YLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDE
PRAIVLHPVMGLMYWTDWGENPKIECANLDGQERQVLVNTSLGWPNGLALDLQEGKLYWG
DAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDV
IIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPRATRCGCPIGLELLSDMKTC
IVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTIS
RAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDL
DNPRSLALDPTKGYIYWTEWGGKPKIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYW
TDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRT
LIQGQLDFVMDILVFHSSRQDGLNDCVHSNGQCGQLCLAIPDGHRCSCASHYTLDPSSRN
CSPPTTFLLFSQKGAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNI
KRAKDDGTQASGPVGRPFVLTSLSQSQNPDRQPHDLSIDIYSRTLFWTCEATNTINVHRL
NGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIR
PVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPMGLTVLGKHLYWIDRQ
QQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGD
GTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEE
GCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAVCLPNQFRCASGQCVLIKQ
QCDPFPDCIDGSDELMCEIAKPPSDDSPAHSSAVGPVIGIILSLFVMGGVYFVCQRVVCQ
RYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGITCSKSMMSSVSLMGGRGGVPLY
DRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVEMFYPSNIPAAARPYRPYII
RGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCSPS
PVTERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences L8Y3J1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]