SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L9KJ60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L9KJ60
Domain Number 1 Region: 949-1045
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-29
Family Ras-binding domain, RBD 0.00085
Further Details:      
 
Domain Number 2 Region: 638-753
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.06e-23
Family Regulator of G-protein signaling, RGS 0.00066
Further Details:      
 
Domain Number 3 Region: 228-361
Classification Level Classification E-value
Superfamily PH domain-like 4.71e-22
Family Phosphotyrosine-binding domain (PTB) 0.026
Further Details:      
 
Domain Number 4 Region: 14-96
Classification Level Classification E-value
Superfamily PDZ domain-like 1.28e-19
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 878-963
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000165
Family Ras-binding domain, RBD 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L9KJ60
Sequence length 1399
Comment (tr|L9KJ60|L9KJ60_TUPCH) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:ELW62768.1} KW=Complete proteome; Reference proteome OX=246437 OS=Tupaia chinensis (Chinese tree shrew). GN=TREES_T100000776 OC=Mammalia; Eutheria; Euarchontoglires; Scandentia; Tupaiidae; Tupaia.
Sequence
MYRAGETVKRPLPGTVPPRLRSVEVARGRAGYGFTLSGQAPCVLSSVMRGSPADFVGLRA
GDQIFAINEINVKKASHEDVVKLIGKCSGVLHMVIGEGIGHLESCSSDEEGGLYDGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASSSEPLKLKQRSLSESAAARFD
IGHESVNNPNPNMLSKEEISNVINDDSVFSIGLENHDDFGLDASILNVAMVVGYLGSIEL
PSTSSNLEYDSLQAIRGCMRRLRAEQKIHSLVMMKIMHDCVQLCTDKAGVVAEYPAEKLA
FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGVLRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGVRARAFLDGDADAHQNNSTSS
NSDSGIGNFNQEEKSNRVLVVDLGGTSSRHGPGSSPAWEGVGGRASQSWGASWNGTFCHD
PEGGASFEATPQADRFRDLNKHIEVPPASLRSSVPPSKRGAAGTGCGFNQRWLPVHVLQE
WPCGQASDQESYTDSTDGWSSVNCGTLPPPXVEGSFAQPPLSGQKWDWSRKAFGVQNIFS
PHRNVRKTKEDKKSATVSDGELTGADLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWA
VSFERLLQDPVGVRYFSLSYRAREIFSKFLCSKATTPVNIDSQAQLADDILNAPHPDMFK
EQQLQIFNLMKFDSYTRFLKSQLYQECILAEVEGRALPDSQQVPSSPASKHSIGSDHSNV
STPKKLSGKSKSGRSLNEELGDEDSEKKRKGTFFSWSRNRSTGRSQKKKEHGDHSNDPLH
ANGGLYRRESQGSVSSAGSLDLAEACRTSAPERDKAAKHCCIHLPDGTSCIVAVKSGLSI
KEILAGLCERHGINGAAVDLFLVGGDKGVPVRSHFNSGLFVPKPLVLHQDSSILESRDLR
LEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLNGLLVRLSGEKEPLDLG
APISSLDGQRVILEEKDPSRGKGAHAVGPYGTGEPCVGAVASTDKQKGAAVKQNTAVNSS
SRNHSATGEERTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEF
FELISKAQSNRADDQRGLLRKEDLVLPEFLRLPPGSTELSLSTPVTAKGFSKRTATSNGK
EKATQPGDRQEPAHDYSDSPVSSPATSTGSAHSPSGPPGTTPPGQNSPSGPFCAPLPPTP
HMQEGATQIWKRQSREVEAGGIQTVEEEHVADLTLIGEGDISSPNSTLLPPPSSPQDTPG
PPKPGGGARRSQGLPANSIIDVDLVVGLAPELGSSVLGTRPGPGKLRVRGPLMSDLPGLS
PTPAEPSKPKASTHHATFV
Download sequence
Identical sequences L9KJ60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]