SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for L9V724 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  L9V724
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.57e-33
Family GHMP Kinase, N-terminal domain 0.0000496
Further Details:      
 
Domain Number 2 Region: 155-284
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.11e-27
Family Homoserine kinase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) L9V724
Sequence length 293
Comment (tr|L9V724|L9V724_HALVD) Homoserine kinase {ECO:0000256|HAMAP-Rule:MF_00384} KW=Complete proteome OX=309800 OS=14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii). GN=C498_06975 OC=Haloferax.
Sequence
MVTVRAPATSANLGSGFDVFGVALDRPADIVHVERADRTTIEVTGVGSQYIPTDPDRNVV
GAVAEALDAPAHIRIDKGVRPSSGLGSSAASSAAAAVALNELYDRGLSREELVPVAAEGE
AVVSGEAHADNVAPALLGGFTVATDEGVTTVDADIPLVACLPEIAVSTRDARRVVPSDAS
IEDMVHTVGRAATLAVGMCRRDADLVGAGMDDRVVTPARAKLINGYHDVREAALAAGATG
VTVSGAGPSVLGVCQAADRTRVAGAMLEAFDEADVAARAYKTRVGRGAEVFES
Download sequence
Identical sequences D4GWI7 L9V724
WP_004042228.1.66890 WP_004042228.1.84848 gi|292656466|ref|YP_003536363.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]