SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0KL07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0KL07
Domain Number 1 Region: 133-398
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.98e-88
Family Enolase 0.00000139
Further Details:      
 
Domain Number 2 Region: 3-129
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.98e-36
Family Enolase N-terminal domain-like 0.0000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0KL07
Sequence length 401
Comment (tr|M0KL07|M0KL07_9EURY) 2-phosphoglycerate dehydratase {ECO:0000256|HAMAP-Rule:MF_00318} KW=Complete proteome OX=662475 OS=Haloarcula californiae ATCC 33799. GN=C435_04363 OC=Haloarcula.
Sequence
MTLITDIRLRRVLDSRGNATVEADVLTESGGFGRGKAPSGASTGEYEAIELPANEAIAKA
REEALPRLIGEVHAGNQRDVDAALHAADGTDDFSGIGANSAVAISMAAAKAGADVLGAPL
YQHLGGTFRGNEYPTPLGNIIGGGEHAADATNIQEFLAAPVGAPSVEEAVFANAAVHQEV
HDILADRDLPAGKGDEGAWAPSVSDDEAFEIMDEAVETVADDFGFAISFGLDVAGAELYD
DEADGYVYDDGVKSTEEQIEYIAGKVEEYDLVYVEDPLDENDYEAFADLTAQVGDQTLVC
GDDLFVTNVERLQAGINADAGNSILIKPNQIGTLTDAVDAIELATASGYESVVSHRSGET
EDTTIAHLAVATDAPFIKTGAVGGERTAKLNELIRIEDNAV
Download sequence
Identical sequences M0JTZ1 M0KL07 P29201
gi|55377005|ref|YP_134855.1| 272569.rrnAC0069 WP_004963339.1.69175 WP_004963339.1.82819 WP_004963339.1.84793 WP_004963339.1.89716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]