SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0QYS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0QYS3
Domain Number 1 Region: 124-307
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.15e-49
Family DBL homology domain (DH-domain) 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M0QYS3
Sequence length 307
Comment (tr|M0QYS3|M0QYS3_HUMAN) Rho guanine nucleotide exchange factor 1 {ECO:0000313|Ensembl:ENSP00000470042} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ARHGEF1 OC=Catarrhini; Hominidae; Homo.
Sequence
XTSVPALVSPRLCPCPGFSSSLFLSWSLLVSVPGICLTLSLASGSRLSGRLGRSESLRVS
DRRRPSRGSLGAKGRGGGRSRSDVDMDPSSATAVLGPARRATPEPGDEGEPGRSGLELEP
EEPPGWRELVPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFF
PLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDGAEGSWFQKIS
SRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLL
QSIGQNT
Download sequence
Identical sequences M0QYS3
ENSP00000470042 ENSP00000470042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]