SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0S9T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0S9T4
Domain Number 1 Region: 307-629
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.03e-49
Family Ankyrin repeat 0.0000971
Further Details:      
 
Domain Number 2 Region: 88-339
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.35e-23
Family Ankyrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  M0S9T4
Domain Number - Region: 26-83
Classification Level Classification E-value
Superfamily NTF2-like 0.00347
Family BaiE/LinA-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0S9T4
Sequence length 761
Comment (tr|M0S9T4|M0S9T4_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr2P20930_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN= OC=Musa.
Sequence
MAVFSHSTGRGCGGGGGSGGRGAAAASQRLVEAAQRGDVRAAAECLADPAVDVNHVGAVC
LRGRRVEVALREEAADEVRVEWEELRTDASALFLAAQAGDLPFVRTLLEKGADVNQKLFR
GHAITAAVREGHAEVVEVLLKAGASQPACEEGVVEASLHGRARLAELLMGSDLVRPRVAV
HALVSAASRGFVDVVDGLIKCGVDANATSRLLLRSLKPALHTNVDCTALVAAIVGRQAAV
VRRLLQAGARMDAKVRLGAWSWDAATGEEFRVGAGLAEPYTPAWCAVEYFESTGTILRML
LQHHSPNAPHHGRTLLHHAILCGNPRAVDTLLSCGADWELPVRAGRKTEFRPIHMAARLG
LASVMQVLVDKRCDLSSTTDAGETALMLCARYKRGDCLRILASSDADLGRKSLAGASAAA
IAASSNWSVGFQHAVLDVIRSGTVPRSSDPSVFSPIMFAAQHGDVASLQVLLTQPDINID
QRRGNGYSPVMVAAKEGHVEAFRVLVFAGANVRLRSEAGETAIDLFRLNENHDMFEQAML
ELALEKGSAGGFHALHFAARRGDMAALRLLTKTGWDVNALDGDGYTPLMLAAREGHAEAC
QLLILQGARCDVETRRGETALSLARSNAKLGKEAESVILDELARVLVVRGDHVKKHTRRG
KGPPHGKVLRMVAAAGVLRWGSSGRRNVVCREAEVGASPAFVRNSKGRGDAREPGLFRVV
TTRKREVHFVCEGGEAAAELWVRGIRLVTRAASGKGGSELN
Download sequence
Identical sequences M0S9T4
GSMUA_Achr2P20930_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]