SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0SA33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0SA33
Domain Number 1 Region: 204-274
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-17
Family Ankyrin repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 7-69
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.79e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M0SA33
Sequence length 295
Comment (tr|M0SA33|M0SA33_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr2P21920_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN=103976731 OC=Musa.
Sequence
MAETPPPFQESSRCDVCNCSFTTFRRRHHCRCCGRTLCHEHSSNYMALPQFGIYSDVRVC
SDCLNNSPRSQKDDTQALANSSDVGADSISRLTLHENTDLVAKATSGESIVGVPECKCGM
PLCICVTPTPEPAPMQMQGTTMLNIQSNPKPRKTSSSQQPAESISRKHAATSSSKPSSFF
NLGQASNNAVDEACANYDVSGEGLREAIKNSDSTAVRELLSKGVDPNYCDKQGLTLLHLA
AVFNQTEIAFILMDHGASTESKNAQGETPLDCAPTMLQYKMRKKAEELAGTAQAI
Download sequence
Identical sequences M0SA33
XP_009390314.1.42102 GSMUA_Achr2P21920_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]