SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0SB94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0SB94
Domain Number 1 Region: 330-442
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000023
Family Ankyrin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0SB94
Sequence length 623
Comment (tr|M0SB94|M0SB94_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr3P02760_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN= OC=Musa.
Sequence
MDLVHLVKDNQAEDVLCSEMEIDENDVLSCMNDHHNVGSEKGEGSTVVFSREAPLLTKDA
LISKDYGCGSKKIRSRASVLMEESEVRSKDKWKQEKKLSRQDRIELGRLFQRVVSSQDSE
LAENLIQLADPQTLNDMLCIALDSIWFLTNRQELNIITGLIKKIVANGANEFTRAALRTS
FLASCVSACQSRTMSLADTVGIMAQRLHERLQECHSDEVLKAEAGAKVQKFTEWALKCIG
IHCRCQENKGRRNHSTIVEVQLQLSAFKTFLDIAGNHLSGKDFTEAFDAACFPLTLFSSS
FEPGWASGTSATAIQGLLGMLVEGGADNVNQCFLEASRFGSTELVRILLQIAQRNSLDVD
VDLALGFASHYSKIGTMECLVEEGNAGAFLGPLMRAAERGCMQVVEWFVTRGCKDMELCL
ALTAAASSSQVGIAAYLLPHIPQHVLAALSIEILKAAGERSSGSLDGVVFLLRSDFLGDP
AATYAVADSMARSSDESVASDLRAFLKEHWSEAAFAEGLRFGQDHFVNIMRIFRRGSSPI
HLKDLPQPLVTAIAYLPLYRECLEAGGQLLPQKLRGQLVEAAHRVSGRPVSKNSQTRELM
AILEHHLPTFFLQAPTVSRAAYR
Download sequence
Identical sequences M0SB94
GSMUA_Achr3P02760_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]