SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0SIZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0SIZ2
Domain Number 1 Region: 49-169
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000171
Family Ankyrin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  M0SIZ2
Domain Number - Region: 266-296
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00294
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0SIZ2
Sequence length 623
Comment (tr|M0SIZ2|M0SIZ2_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr3P29760_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN= OC=Musa.
Sequence
MCGGPGRLKSSASSSLSPSPTSQEEHQQRSLAAGMSRLTVEIDSFSLSLLELAANNDVDA
LRLFLDRDPSAVDEVGLWYGRRKGSNRMVLEQRTPLMVAATYGSLDVLKLILSLPSVDVN
RVAGLDSTTALHCAASGGSLEAVDAVKMLLAAGADPALVDANGNRPADAIVVPPKLPDVK
TGLEQLLGRSTNASGGSDNHHHPLRKKEYPVDPSLPDIKNSIYSTDEFRMFSFKIRPCSR
AYSHDWTECPFVHPGENARRRDPRKYHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHP
AQYRTRLCKDGTGCSRRVCFFAHTNEELRPLYVSTGSAVPSPRSSSAAMEMAAAMGLMPG
SPSSVSAVMSPFTPPMSPSANGIGHSSASWPQPNVPTLTLPASNLQSSRLRSSLSARDMP
VDDLSVISETKALTPSNLDDLFSSEIASSPRYNSDQGSIFSPSHRTAVFNQFQQQQSLLS
PINTNVFPPKARERQQQSLRSLSSRDLGPISSPIVGSPVNSSWSKWASPSGVPDWGVNSE
ELGRLRRSSSFELRGNGEEPDLSWVHSLVRESPTEKVVSVATAPTGPTGGAECLNSNVEM
DGHDQAAVLGAWLEQMQLDQIVT
Download sequence
Identical sequences M0SIZ2
GSMUA_Achr3P29760_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]