SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0T0E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0T0E8
Domain Number 1 Region: 190-321
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-16
Family Ankyrin repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 11-98
Classification Level Classification E-value
Superfamily E set domains 0.000000000000098
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.002
Further Details:      
 
Domain Number 3 Region: 379-438
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000982
Family Motor proteins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M0T0E8
Sequence length 532
Comment (tr|M0T0E8|M0T0E8_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr5P21190_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN= OC=Musa.
Sequence
MATSMGDHVFNITEISPGWSYSTEETKVVVVGHFCESKKHLMSSSIYCVVGEICVKAEMV
QPGIYRCKVSPQPPGLVNLYLTMDGHTPVSQVLSFDYRCSPNIQLDGQIFPSEDDRNKLK
WEDYQVQKRLAHLLFATSNNTSILSSRIPLKSLNEAKRFAMLTSSLIEKDWTNFLKLDST
NKFSSASTRENLLELVLRNKLQEWLLVKVAEGCETPGHDSQGHGVIHLCAILNYAWAVRL
YSLSGLSLDFRDIHGWTALHWAAYCGREKMVATLLSAGANPSLVTDPTSETRGGCIAADL
ASKQGYEGLAAYLAEKGLTAHFQAMTLSGNITKHGMPTTNTLADSENVERALKLQTKAVQ
LVKPEMEASQIVAALKIQHAFRNHNRWKLMKAAARIQSHFHTWKIRRDFVNMRKKAIKIQ
AAFRGHRVRKQYRKIVWSVGVLEKALLRWRLKRKGLRGVQVKTTKTMNMTPESTGEEEFY
RISRVQAEERMQRSVVRVQAMFRSYRAQQEYRRMKMAHEQAKLEFCDMGQLQ
Download sequence
Identical sequences M0T0E8
GSMUA_Achr5P21190_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]