SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M0TE16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0TE16
Domain Number 1 Region: 132-190
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.87e-19
Family PHD domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0TE16
Sequence length 216
Comment (tr|M0TE16|M0TE16_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr7P02260_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN=103990859 OC=Musa.
Sequence
MAKTKPGKKDLDSYTIKGTNKVVKVSDCVLMRPAESEKPPYVARVEKIEADHRNNVRVRV
RWYYRPEESIGGRRQFHGAKELFLSDHYDMQSAHTIEGKCIVHSFKNYTKLENVGAEDYF
CRFEYKAATGAFTPDRVAVYCKCEMPYNPDDLMVQCEGCKDWFHPSCMGMTIEQAKKLEH
FLCSDCDSENDAKRSMNGFPASPINEPKAEPKRRKR
Download sequence
Identical sequences M0TE16
GSMUA_Achr7P02260_001 XP_009408417.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]