SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0TNI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0TNI8
Domain Number 1 Region: 228-616
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.92e-95
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 14-123
Classification Level Classification E-value
Superfamily PH domain-like 4.43e-26
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 615-685
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.24e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0TNI8
Sequence length 1105
Comment (tr|M0TNI8|M0TNI8_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr8P07850_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN=103993562 OC=Musa.
Sequence
MADLLGSANADRDIDKALIALKKGAQLLKYGRKGKPKFCPFRLSNDESTLIWFSGGGERT
LKLASVLRIVPGQRTPVFQRYLRPDRDYLSFSLIYNDGKRSLDLICKDKVEAEVWFSGLK
ALISTGQYGRSKIDGWNNGGLNTDDSRGSASNSISDQSIGSTLDSSESRLTSSSIPKNLS
FEYSVTSDISDATNMHVKGVSSDGFRVSISSVPSTSSHGSAQDDFDAAGDVYVWGEVICD
TSTRISADKNSSPSSARSDILLPKPIESNVVLDVHHVACGVRHAALVTRQGELFTWGEES
GGRLGHGVGMDIIHPRLLESLSTFNVDYVACGEFHTCAVTATGELYTWGDGAHNAGLLGH
GTNVSHWMPKRVSGPLEGLQVSYVSCGVWHTAIVTTAGQLFTFGDGTFGVLGHGNRETVL
YPREVESLAGLKTIAVSCGVWHTAAVVEVMVTQSSASSGKLFTWGDGDKYRLGHGDKVAR
LKPTCVPSLIDYNFHRLACGHSLTIGLTTSGQVFTMGSNVYGQLGNPRSDGKLPCMVEDK
LAGEPVGEVACGSYHIAVLTTRGEVYTWGKGANGRLGHGDFEDRKTPTLVEALKDRPVKQ
ISCGSNFTAAICQHKWISGAEQSQCSACRQAFGFTRKKHNCYNCGLVHCHQCSSRKALRA
ALSPNPGKPYRVCDSCYVKLNSGLEPGGVNNKKNAKPWISTESKDKFDKVDTLPKASLSR
NLELIKSLDIKTAKNGKNTNFMYMTQNPKGSSVSPLKSLAFPGGIDMLQAVSKPVQTTGA
NSANRSRAVSPFSRKSSPPRSTTPTPTTSGLSFTKNISDSLKKTNDLLNQELLKLRSEVD
SLRQRCERQDFELQKAEKKAKEAMTVAAEESTKSKAAKEVIKSLTAQLKEMAERLPHGTY
GTNTTIPMHLPNGVESHAIQHIGSSGEHLFINDAGNIANMAPSRTGYLGQINENSGDNTS
VREIYRPNETSAPPTPKIVNAKMEQNLNPQNAGQGEMWASSTRLKDIDSRTIASPQSHDD
AVSAVRSPSELSNDVEAEWIEQFEPGVYITLVTLRDGTRDLKRVRFSRRRFGEQQAEAWW
SENRERVYEKYNFRVPDRTSSAMLT
Download sequence
Identical sequences M0TNI8
XP_009411942.1.42102 GSMUA_Achr8P07850_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]