SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0TSU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0TSU8
Domain Number 1 Region: 267-446
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.71e-45
Family Ankyrin repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 45-234
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.05e-40
Family cAMP-binding domain 0.00034
Further Details:      
 
Domain Number 3 Region: 3-42
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000132
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M0TSU8
Sequence length 541
Comment (tr|M0TSU8|M0TSU8_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr8P22950_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN= OC=Musa.
Sequence
MITGYGDIHAVNPREMVFIMIYVSFDMILGAYLIGNMTALIVKGSKTERFRDKMKDLIRY
MNRNRLGKDIRDQIKGHVRLQYESSYTEASVLQDIPASIRAKISQTLYRPCIENVPLLKG
CSSEFINQIVIRLQEEFFLPGELILEQGNAVDQLYFVCHGVLEGIAVGEDGSEETVTQLE
PSSSFGEIAILCNIPQPYTVRVCELCRLLRLDKQLFTNILEVYFVDGRTILSNLLEGNES
TLRIKQLESDITSHIGKQEAELALKVNSAAYYGDLRHLKGLIRAGADPKKTDYDGRSPLH
LAASGGFEDITIFLIREGVDINLSDNFGNTPLLEAVKHGHDRVASLLHSKGAKLHLKDAG
SQLCAAVARGDSDFIRRILNYGVDPNSSDYDHRTPLHIAAADGLYSIAKILLEAGASVFA
IDRWGSTPLDEAVKCGSKSLMMMLEDAKLEELSKFPDRGTQTQDKTQPRRRCTVFPFHPW
DPKEKRKEGVVLWVPLTMEELIESSQELLNCSGSRILSEEGGRISDVAMICDNQKLYLVA
D
Download sequence
Identical sequences M0TSU8
GSMUA_Achr8P22950_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]