SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0TYW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0TYW1
Domain Number 1 Region: 125-325
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 9.05e-38
Family Guanidinoacetate methyltransferase 0.0015
Further Details:      
 
Domain Number 2 Region: 9-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.2e-18
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M0TYW1
Sequence length 332
Comment (tr|M0TYW1|M0TYW1_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr9P09520_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN=103997354 OC=Musa.
Sequence
MAKSAEEQLCEAAVEGDCAKIGDLLSAGADPTYFDASGMTPLMYAARHGHADSARLLLSA
GAPWNALSPSNISAGDLAMEHAHQEAFDVLLNAGIQAELVLGTIARVAERNGEKEGGGLN
YLEDRVSFSEDKLMDSESKAVMMEWERPLMEAHARAVCGGGGKVLNVGFGMGLVDEAIQR
YGPVEHTIVEAHPEVYERMLRSGWGKKENVKIVFGRWQDVLPQLESYDGVFFDTYGEYYE
DLRQFHQHLPRLLKPGGVYSYFNGLCGDNAFFHVVYCQLVALELGNLGYSTQFIPLPVKD
CLTEEVWEGVKRKYWQLDTYYLPVCQPLSDSE
Download sequence
Identical sequences M0TYW1
XP_009416813.1.42102 GSMUA_Achr9P09520_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]