SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0U2S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0U2S8
Domain Number 1 Region: 22-144
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-29
Family Ankyrin repeat 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0U2S8
Sequence length 172
Comment (tr|M0U2S8|M0U2S8_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_Achr9P23190_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN=103998745 OC=Musa.
Sequence
MSPEQQVKTRNYISSRRLFKHRLRERDDRGWTLLHIGARKGDLKEVKRLLDAGMDVNVTA
LGCKALGVTPLHLAAQGGHINVMDELLERGANIDARTKGACGWTPLHIAAKERNKQAIKF
LIENGAFLPPDINDNRFNPPLHYCPGLEWAYEIKHKQEEWLSSSGTSYSSEN
Download sequence
Identical sequences M0U2S8
XP_009418586.1.42102 GSMUA_Achr9P23190_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]