SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0UAZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0UAZ6
Domain Number 1 Region: 321-433
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000142
Family Ankyrin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M0UAZ6
Sequence length 605
Comment (tr|M0UAZ6|M0UAZ6_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_AchrUn_randomP20880_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN=103974639 OC=Musa.
Sequence
MTPEDCMCLVKERQPEKEVDENGGLGPAHDGDEGERVDGSNHLFLREAPILTEESGISKD
YNCQDKKVGSREELVLRKDMCKQGTKLSRRDRVELGCRFQRAVSSCDWELAWNLLVLAKA
QALNDVLCVALDSVWFLTTHEELDGITGLIKKIIGDGANDFTRAILRTSFLASCVSACQS
KMMNLTDAVGVTTQRLHERLQECQGDEVLKVEASTKVQKFTEWALKCIRFHSHYQENRGR
RRRNQSTIVEVQLQLSAFKTFLELAGDHLTGKDFTEAFDAACFPVALFSSSFDPGWASGI
SAIAVQGLLGMLVEGGADNVNQCFLEASRFGSTELVRILLQIAQRNSLDIDVDLALVFAS
HYCKIRTMECLVEEGNAANLLGPLVRASERGCMQVVQWFVNQGCGDMDLCLALIAATSSS
HLGVSAYLLSQIPHHVLAAVSIEILKTVSERSRGSLDGVAFLLCNDFLGDPTATYAVADS
IASSNDEVVAPELRAFLKEHWSEDAFAEGLSSGQDHYVNFMRILQRGGSPICLMDLPPPL
VTAIVYKPLYRECTEAGGKLLPQKLRGKLVEAASRLGGRQVDNDSPAKELLAILEHHLPR
HFLPL
Download sequence
Identical sequences M0UAZ6
GSMUA_AchrUn_randomP20880_001 XP_018677430.1.42102 XP_018677431.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]