SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0UBS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0UBS5
Domain Number 1 Region: 529-631
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.31e-18
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 342-427
Classification Level Classification E-value
Superfamily E set domains 6.07e-17
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 739-793
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000717
Family Motor proteins 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0UBS5
Sequence length 917
Comment (tr|M0UBS5|M0UBS5_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_AchrUn_randomP23670_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN= OC=Musa.
Sequence
MHIVLVHYLEVKGHKPSFSRNREVEDVPQDNQVDSPVSSNSITNHSQLPSQATDVESPIS
LHTSEYEDAESAKFDAADNYPTSSRYHPFVKMQQYDDGQMTGVQFVDSYVPDPSIDSQCG
FQEIHDAEPKSDFYSVTQEDIGRVFNETGLGLTFIGSKTQLDLASWEEVLEHCATSHQMP
SFQSSAGITEVTTEEISSKQTSVHADLYAENPGTRQDDSIISDKFEWQLSSADTDSAIIS
TINMENETSIDGSDKYTSLVKQPTLDLSRVQTEGLKKYDSFSRWMSKELGEVDESHTKSS
SGAYWSAVGSDGIVEDSSISNHEPLDAYIMSLSLSQDQLFSIIDFSPNWVYAGLETKVLI
IGTFLKTQDVENCKWSCMFGEVEVPAEVVGDGILSCHAPPHKSGRVPFYVTCSNRLACSE
VREFEFRVSDPHCIENIDSCSNNTYEMLLHMRLDKLLSLGPLDSQSLDYRKKAHLGGKIS
LIKMEAADDTLPKISQENGYSADNAELLEMLLQEKLHIWLLHKSAKDDKGPNIWDEEGQG
VLHLAAALGYDWAIEPTVTAGVNINFRDAHGWTALHWAAFCGRERTVGALITMGAAPGLL
TDPTPEFPSGRTPADLASANGHKGIAGFLAESSLTSHLSSLTLDPKGSDIADVASLTGID
DAEQRALAVADGDMQAGLSLKDSLSAVRNASQAAARIYQVFRVQSFHRKKIESGGDKSAM
SDERALSLLSIKSQKTGHSDMPMHAAAIRIQNKFRGWKGRKDFLIIMQRIVKIQAHVRGH
QVRKRYKKFVWSVGIVEKVILRWRRKGSGLRGFRSEGVLEGTSMQCHLAKEDDYDFLQEG
RKQTEARMQKALARVKSMVQYPEAREQYRRLLTVVTEFQESKALQESIMDVSEDAADAHL
MVELEELLEGDTVMPTV
Download sequence
Identical sequences M0UBS5
GSMUA_AchrUn_randomP23670_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]