SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0UBT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0UBT0
Domain Number 1 Region: 1-42
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000509
Family PHD domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0UBT0
Sequence length 532
Comment (tr|M0UBT0|M0UBT0_MUSAM) Uncharacterized protein {ECO:0000313|EnsemblPlants:GSMUA_AchrUn_randomP23720_001} KW=Complete proteome; Reference proteome OX=214687 OS=Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis). GN= OC=Musa.
Sequence
MVCCDVCERWVHCLCDSISDEKYQQFQADQNLQYKCAACRGDCYQVEDIDDAVRELWKRK
DIADNDLIASLRAAAGLPSHEVTYSISPYSGDEQSGPIILKNDNNKPLKFSLKGISDKSS
EYENTTSNKKQVKKKGYWIKLVGKTEEAYPELDKQDETRSLECRYRDQNIDEMTTFRPDG
PDILSSSAARDPNGNGVKSCTNQLGTFDQSMAKEPASSNADMIPKVKIKSSKLQGLHFKE
CADKSANKIETTRSTKLVIHIGSINRNASNSPKSETSSCHKDQDLVNCFGAKMVNANVMR
TPKHGVKEKTKVKIGKVYVKPQKSNGNVTDECDLNATDLSVERMNEANFAAENDTTERSN
KVCQKKHSADIYVKPQRDSSEMSPSDFTSSSSKDLKTSLKLKFKNPCFEQKSSWAPHGEE
DNTVKGQRSKRKRPSTEKMGGWQDDRSSKLHLENLIDEAMDANWILQKLGKDAIGKRVEV
QPTNSSWHQGVVIDVNQSTSSLSVHLDDGRSTLLELGKQGLRFISQKQRTKS
Download sequence
Identical sequences M0UBT0
GSMUA_AchrUn_randomP23720_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]