SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0UHK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0UHK8
Domain Number 1 Region: 34-128
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-28
Family B3 DNA binding domain 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M0UHK8
Sequence length 213
Comment (tr|M0UHK8|M0UHK8_HORVV) Uncharacterized protein {ECO:0000313|EnsemblPlants:HORVU4Hr1G021650.17} KW=Complete proteome; Reference proteome OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
MAMNPLSQEHPNAWPWGVAMYTNLHYQQYHYEKEHLFEKALTPSDVGKLNRLVIPKQHAE
RCFPLGGESGEKGLLLSFDDEAGKPWRFRYSYWTSSQSYVLTKGWSRYVKEKHLDAGDVV
HFERVRGLGTGDRLFIGCRRRGDVSAPTAVPPPPAVRVVPASGHNPREQQPWSPMCYSTS
GSYPTSPATSHAYRRSAEHDHSDMHHAGKIKAA
Download sequence
Identical sequences M0UHK8
MLOC_11014.10 MLOC_11014.6 MLOC_11014.8 MLOC_11014.9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]