SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M0XS13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M0XS13
Domain Number 1 Region: 5-110
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.26e-17
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 173-267
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-16
Family B3 DNA binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M0XS13
Sequence length 268
Comment (tr|M0XS13|M0XS13_HORVV) Uncharacterized protein {ECO:0000313|EnsemblPlants:HORVU7Hr1G092730.5} KW=Complete proteome; Reference proteome OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
MSKTRPRFIKLLRPDDWEKMTIPDEFVQQHLIGAESCPSSQKALIIGPTGKLWPVELDQR
QSDVLYGEVWAEFLTAHDLSEGSILLFRYEVNMSFSVQVFLPNGCMKEYPYLADEADGSS
PLLPQSDKQLVAPSVSKRSYNKRQVVSGIPATFPAMKAQKVQSQSKPAGVVGRHSFTKQI
TSYSLKSLFAVKLTFCSSIGLLEACTIQLKTSMGGSARSWPVAFNIANTYGFLTGKGWKR
FCQDNEVEEGDRCTFKVVEKMVWHVVIN
Download sequence
Identical sequences M0XS13
MLOC_62500.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]