SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M1CBS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1CBS2
Domain Number 1 Region: 22-325
Classification Level Classification E-value
Superfamily Translation proteins 9.71e-90
Family Ribosomal protein L3 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1CBS2
Sequence length 344
Comment (tr|M1CBS2|M1CBS2_SOLTU) Uncharacterized protein {ECO:0000313|EnsemblPlants:PGSC0003DMT400064117} KW=Complete proteome; Reference proteome OX=4113 OS=Solanum tuberosum (Potato). GN=102590107 OC=Solaneae; Solanum.
Sequence
MSFQVSKYNIYLSFMSCICAELHKKETCEAVTIIETPPMIVVGVVGYVKTPRGLRCLSTV
WAQHLSEEIKRRFYKNWCMSKKKAFAKYSKKYETDEGKKDINAQLEKMKKYCSVIRVLAH
TQIRKMKGLKQKKAHLMEIQVNGGDVAQKVDYAYGFFEKQIPIDAIFQKDEMIDIIGVTK
GKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKV
YRLGKAGQESHSAITEFDRTEKEITPIGGFPHYGVVKEDFLLIKGCCVGPKKRVVTLRQS
LLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKAKFYGRLKA
Download sequence
Identical sequences M1CBS2
PGSC0003DMP400043210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]