SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M1FG77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1FG77
Domain Number 1 Region: 9-314
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 3.27e-91
Family Acetamidase/Formamidase-like 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M1FG77
Sequence length 315
Comment (tr|M1FG77|M1FG77_9ALTE) Putative acetamidase / formamidase {ECO:0000313|EMBL:AFP29353.1} KW=Complete proteome; Reference proteome OX=490759 OS=Marinobacter sp. BSs20148. GN=MRBBS_0415 OC=Alteromonadaceae; Marinobacter.
Sequence
MCQQTLVKTIHGGHHHHGWDNSFAPVARVAPGSMVELECKDSGNGHFTTDSTVAAVSSMP
FDKINPVTGPIYVEGAEPGDILKVTIDSFRPSGFGWTANIPGFGLLTDQFQNPALMLWHY
DRNNMTPAAFGKFAKVPLKPFAGTIGLALAEPGLHSVVPPRRVGGNLDIRDLNAGSSLYL
PVEVAGALLSIGDTHAAQGDGEVCGTAIESAMDVTVKLDLIKDTPLAMPRFTTAGPVTRH
LDGSGYEAFTGIGPDLMQAARDAVSGAIDWITREHHMPPEQAYMLCSVCGDLRISEIVDM
PNWVVAFYVPRLVFE
Download sequence
Identical sequences M1FG77
gi|399543458|ref|YP_006556766.1| WP_014869732.1.23067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]