SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M1SZD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1SZD7
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily RbcX-like 5.1e-44
Family RbcX-like 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1SZD7
Sequence length 135
Comment (tr|M1SZD7|M1SZD7_9NOSO) Chaperonin-like protein {ECO:0000313|EMBL:AGG34866.1} OX=1297638 OS=Nostoc sp. 'Peltigera cinnamomea cyanobiont'. GN=rbcX OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLELWLHNFSSGKIQNGESYIEQLL
REKPDLALRIMTVREHIAEEIAEFLPEMVRTGIQQANMEQRRQHLERITRIDTSNPSLQP
EQQTTSDQNLDNLSN
Download sequence
Identical sequences A0A023SF35 A0A023SHS9 A0A075QJP5 A0A075QTL4 A0A075QTM0 B2J8T3 M1RWH1 M1SZ90 M1SZD7 M1T014 M1T7A6 Q2LJA6 Q2LJK2
63737.Npun_F4196 WP_012410538.1.44837 359714 gi|186684318|ref|YP_001867514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]