SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M1UW96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1UW96
Domain Number 1 Region: 286-352
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000392
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0015
Further Details:      
 
Domain Number 2 Region: 214-284
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00000000929
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0066
Further Details:      
 
Domain Number 3 Region: 356-455
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0000000432
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M1UW96
Sequence length 461
Comment (tr|M1UW96|M1UW96_CYAM1) Similar to small conductance mechanosensitive ion channel {ECO:0000313|EMBL:BAM82426.1} KW=Complete proteome; Reference proteome OX=280699 OS=Cyanidioschyzon merolae (strain 10D) (Red alga). GN=CYME_CMR181C OC=Cyanidioschyzon.
Sequence
MEKLATQTLSFVPLQGNPFSGVGYHTHRIFSRDARLKLCRWKKRALPAVSVLPRGVGRLL
LAHAGQHQRQALSSLWQAHLSTHVHNLDIGSILETPVSLGGKSRLVAAFTLSDLLVILIL
LVAYRRMVRILARSVLQPAGARLPDKWLTRKLIPADEHGLVRWIESTERAVGLFLTLRLG
VMACQFGLVLGARLGITIWPKLPYVISRLATIGYFAFVLDTFYNWFLYEREDLSLSQIFV
LGRLGTVLIYAVAFLVFVETTGLPLRSILAFGGIGGLAVGLATQELAKNFISGIMLALGA
PFAPGESVQLNTLGVSGQVRQIGFYKTELIGADGRPIWIPNAQLLNERLTNNSRITNRRI
NLRFGLRYQDIDKIGRIVERVREMLAEVPEIAAYRESISVFFTEFAEYSLPIQLSCIVNV
TDGRRFLEIQQQVLIELNRIVKSELADFALPTRAIEYLPPR
Download sequence
Identical sequences M1UW96
XP_005538462.1.94140 gnl|CMER|CMR181C CMR181CT

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]