SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M1XNN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M1XNN8
Domain Number 1 Region: 19-324
Classification Level Classification E-value
Superfamily SAICAR synthase-like 9.81e-47
Family SAICAR synthase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M1XNN8
Sequence length 340
Comment (tr|M1XNN8|M1XNN8_NATM8) SAICAR synthetase {ECO:0000256|HAMAP-Rule:MF_00137} KW=Complete proteome; Reference proteome OX=268739 OS=Natronomonas moolapensis (strain DSM 18674 / JCM 14361 / 8.8.11). GN=Nmlp_1334 OC=Natronomonas.
Sequence
MTSVKGFRIEEAATADSLGTGAFVFTDDYSVFDWGKMPDAIPNKGASLCAMGAANFERLE
AEGIATHYRGVVSGGGAVTGLDSVATPPREMAIELTRVPDLPHEGREYDYTAYHDAAGEN
YLIPLEIVFRNTVPVGSSLRSRADPGDFGLEYDAWPDGPVDLPEPVVEFSTKYEESDRYL
SRENADYVAGAADVDALESIARDVNRIITETAAAAGLKHEDGKIECLYYDGEIRVADVVG
TFDENRFSYAGQQLSKEVLRQYHKRTQPEWVEAVAEAKSEAKAEDVADWRELCGVDPEPL
PAHVVDAAREMYTAGTNAYLGRDLFDAPALEDAVAAIESF
Download sequence
Identical sequences M1XNN8
WP_015408389.1.26724 gi|452206188|ref|YP_007486310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]