SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M2YPC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M2YPC3
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.01e-40
Family Deoxycytidylate deaminase-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M2YPC3
Sequence length 151
Comment (tr|M2YPC3|M2YPC3_PSEFD) Uncharacterized protein {ECO:0000313|EMBL:EME79605.1} KW=Complete proteome; Reference proteome OX=383855 OS=fungus) (Mycosphaerella fijiensis). GN=MYCFIDRAFT_64442 OC=Pseudocercospora.
Sequence
MSTDDAGFTAALEEAQQGFEEGGVPIGACLVAADGTILGRGHNMRVQENSAILHGETSAL
ENAGRLPASAYKGSTMYTTLSPCNMCTGACILYKVSRVVMGENNTFVGGEELLRQHGIEV
VNLQNAECEQLMKDFIAKHPEDWYEDIGEDV
Download sequence
Identical sequences M2YPC3
XP_007929791.1.3604 jgi|Mycfi1|64442|fgenesh1_pm.C_scaffold_11000039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]