SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3TWA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3TWA9
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.53e-25
Family N-acetyl transferase, NAT 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3TWA9
Sequence length 147
Comment (tr|M3TWA9|M3TWA9_ENTHI) Acetyltransferase, GNAT family protein {ECO:0000313|EMBL:EMH73680.1} KW=Complete proteome OX=885319 OS=Entamoeba histolytica HM-1:IMSS-B. GN=EHI8A_060190 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MIWHFKQLNQFTQEEVDQVYTIRKEVFSEGGEKDLGHPPMDESDQYCYHSFGWDENGIVC
YCRVIQEEQGIYKIARVLVHQNHRRKGMGQKLINYTCDQIKNLFDGKKVILSALEDIHTM
YLKIGFNKTGSFCDFNGIPAIDMQREL
Download sequence
Identical sequences A0A175JHE6 C4LW21 M3TWA9 N9UZK6
XP_649393.1.49425 jCVI|EHI_141360 gi|56465829|gb|EAL44012.1| gi|67466491|ref|XP_649393.1| 294381.C4LW21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]