SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3W2I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3W2I7
Domain Number 1 Region: 669-815
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.02e-39
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 995-1092
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.31e-30
Family Ras-binding domain, RBD 0.00079
Further Details:      
 
Domain Number 3 Region: 215-366
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-20
Family Phosphotyrosine-binding domain (PTB) 0.0097
Further Details:      
 
Domain Number 4 Region: 12-99
Classification Level Classification E-value
Superfamily PDZ domain-like 2.13e-19
Family PDZ domain 0.0097
Further Details:      
 
Domain Number 5 Region: 941-1009
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000568
Family UBX domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3W2I7
Sequence length 1392
Comment (tr|M3W2I7|M3W2I7_FELCA) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSFCAP00000004263} KW=Complete proteome; Reference proteome OX=9685 OS=Felis catus (Cat) (Felis silvestris catus). GN=RGS12 OC=Felinae; Felis.
Sequence
MYRAGDAVQRPLHGPAPPRLRSVEVARGRAGYGFTLSGQAPCVLSCVLRGSPADFVGLRA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIGEGLGHVESCSSDEEVGFYEGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLRASSSEPLKLKQRSLSESAAARFD
LGRESVNHPNPNLLSKEEISKVMNDDSVFSIGPENHEDFALDASILNVAMVVGYLGSIEL
PSTSCNLESDSLQAIRGCLRRLRAEQKIHSLVTMRVLHDRVRLCTDQAAVLAEYPAEKLA
FSAVCPDDRRLFGLVTMQTSDDGSLAHEDEGALRTSCHVFMVDPDLFNHRIHQGIARRFG
LECTADPDTGGCLEFPASCLPALQFISVLYRDMGELIEGVRARAFADGDADAHQNTSTSS
NSDSGIGNFHQEERSSRVLVVDLGAGSSRHGPGGGGGWEAAGGRGSQPRGAPWSGAFCLD
PEGGPPFEAAPQADRCRDFGKHLGPAAHVELPPASSRSSVPLSKRGAAGHGQRWLPVHVL
QEWPCGHASDQESYTDSTDGRSSVNCSLAQAPLSTQKRDWSRKAFGVQNLFGPHRQVRKT
KEDKKGSKFGRGVGLTQTSQRTSARRSFGRSKRFSITRSLDDLESATVSDGELAGADLKD
RASDHSLSSNASLPSVQSCRRLRERRAASWAVSFERLLQDPLGVRYFSDFLRKEFSEENI
LFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDILSAPHPDM
FKEQQLQIFNLMKFDSYTRFLKSQLYQECILAEVEGRSLPDAQQVPGSPASKGSVSSEHS
GVSTPKKLSGKSRSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQKKKEHGDHANEP
LHANGGLGRRESQGSVSSAGSLDLSEACRTSVPERDKVARHCSVQLPDGTSCVVAVQAGL
SIKEVLAGLCERHSLNGAAVDLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPI
NRSVGLKAKPTKPVTEVLRPVVAKYGLHLNELVARLSGEKEPLDLGAPISSLDGQRVILE
ERDPSRGKDKQKSAPGKQNVAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLS
KREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLRLPPG
PLELALPPPAAAKGLGKRSFTSNGEEKAPRAQEPWGPVQDCHESPGTSPSSAESPPFSSP
QTPTPHAQEAAAGGVQTMEGEHVADLTLTGEGDISSPNSTLLPPAPTPQDSAGPPRPGGG
ARGSQGLPVNTIIDVDRVAGLAPGPGSSIPRVRTGPQRSRASGPLTSDLRSLSPVPGGPA
KPKAGPHHATFV
Download sequence
Identical sequences M3W2I7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]