SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3XLU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XLU3
Domain Number 1 Region: 121-232
Classification Level Classification E-value
Superfamily SH2 domain 1.33e-31
Family SH2 domain 0.0000288
Further Details:      
 
Domain Number 2 Region: 247-308
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-22
Family SH3-domain 0.0004
Further Details:      
 
Domain Number 3 Region: 92-133
Classification Level Classification E-value
Superfamily SH3-domain 0.000000025
Family SH3-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XLU3
Sequence length 309
Comment (tr|M3XLU3|M3XLU3_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000000043} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MGGRGDPLPGLPGESPRVIPGLWGSKVEAQPLTGSPCSVTCQLPVSPPSGAASKAQHTLK
TKEDGSSGPRLQRKQEELTQLGAQLLGPGDSGMESVALYSFQATESDELAFNKGDTLKIL
NMEDDQNWYKAELRGAEGFIPKNYIRVKPHPWYSGRISRQLAEEILMKRNHLGAFLIRES
ESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNELVDFYRTTTIAKQRQVFL
RDEETPLKAPQACFAQAQFDFSAQDSSQLSFHRGDIIEVLEHLDPHWWRGRLCGRIGFFP
RSYVQPVQL
Download sequence
Identical sequences M3XLU3
ENSMPUP00000000043 XP_004776606.1.14098 ENSMPUP00000000043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]