SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3XNK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XNK5
Domain Number 1 Region: 38-102
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000401
Family Flavin-binding PAS domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XNK5
Sequence length 130
Comment (tr|M3XNK5|M3XNK5_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000000655} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNVTSRSSAFGGYGEPKNYV
EFEIEEDFLC
Download sequence
Identical sequences M3XNK5
ENSMPUP00000000655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]