SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3XNK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XNK6
Domain Number 1 Region: 38-105
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000541
Family Flavin-binding PAS domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3XNK6
Sequence length 155
Comment (tr|M3XNK6|M3XNK6_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000000656} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGVLMIRKLKILLSLKSLR
YRNVLSLIGNQIFENRKNKPRIILAIIKNPKDNSC
Download sequence
Identical sequences M3XNK6
ENSMPUP00000000656 ENSMPUP00000000656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]